Genaxxon bioscience GmbH, 22 yılı aşkın süredir güvenilir bir ortak olmuştur. Özel ekibi ile yalnızca birinci sınıf ürünler sunmakla kalmıyor, aynı zamanda laboratuvar çalışmalarınızı optimize etmek için kişisel iletişim ve hızlı teknik destek de sunuyor.
ISO 9001:2015 sertifikalı bir şirket olarak, 20 yılı aşkın süredir müşterilerimizin PCR, RT-PCR ve gerçek zamanlı PCR’yi (qPCR) güvenilir ve tekrarlanabilir hale getiren yüksek kaliteli moleküler biyoloji ürünlerinden oluşan geniş bir portföy sunmaktadır.
Ayrıca yetkin Genaxxon ekibi, Müşteriye özel hücre kültürü besi yeri veya özel ambalaj miktarları gibi özelleştirilmiş ürünlere yönelik özel taleplerde bile destek sağlıyor ve soruları hızlı ve doğrudan yanıtlıyor.
Genaxxon, biyobilimi sürdürülebilir bir şekilde üretim ve ticaret yapmaktadır. Almanya’daki üretimleri sayesinde kısa mesafeler, çevre dostu ambalaj malzemeleri ve CO2 nötr nakliye, en başından beri yüksek bir öncelik olmuştur.
- PCR Ürünleri
PCR kimyasalları - RNA DNA Protein Saflaştırma
Agaroz - Moleküler Biyoloji
Agaroz - Hücre Kültürü Ortamı
Hücre kültürü besiyerleri (Dmem F12, F12K, Alpha Mem), - Hücre Kültürü Reaktifleri
Collagenase çeşitleri - Buffer
- Biyokimyasal
Ethidium Bromide, DMSO - Peptitler ve Proteinler
İçerik henüz mevcut değil.
Kategori | Alt kategori | Ürün kategorisi | Ürün alt kategorisi | Kod | Açıklama |
---|---|---|---|---|---|
PCR Products | PCR Master Mixes | M3014 | PCR Master Mix (2X) | ||
PCR Products | PCR Master Mixes | M3007 | SuperHot Master Mix (2-times) | ||
PCR Products | PCR Master Mixes | M3029 | RedMasterMix (2x) - PCR Master Mix with red dye | ||
PCR Products | PCR Master Mixes | M3221 | RedMastermix Hot (2x) Hotstart Master Mix with red dye | ||
PCR Products | PCR Master Mixes | M3007b | SuperHot Master Mix Blue (2X) | ||
PCR Products | PCR Master Mixes | A770101 | AQ97 High Fidelity Master Mix 2X | ||
PCR Products | PCR Master Mixes | A790801 | AQ97 Hot Start High Fidelity PCR 2x Master Mix | ||
PCR Products | PCR Master Mixes | M3024 | 5X qPCR Multiplex Master Mix | ||
PCR Products | PCR Master Mixes | M3013 | Multiplex HS Master Mix (2X) | ||
PCR Products | PCR Master Mixes | M3026 | Lyophilized 5x qPCR Multiplex Master Mix | ||
PCR Products | PCR Master Mixes | M3071 | LyoMix - Lyophilized qPCR Probe Master Mix powder | ||
PCR Products | PCR Master Mixes | M3069 | LyoBalls - Lyophilized qPCR Master Mix - pre-dispensed (0.1mL wells) | ||
PCR Products | PCR Master Mixes | M3070 | LyoBalls - Lyophilized qPCR Master Mix - pre-dispensed | ||
PCR Products | PCR Master Mixes | M3005 | LyoPlex Multiplex PCR Master Mix - lyophilized | ||
PCR Products | PCR Master Mixes | M3286 | FAST DNA Polymerase (2X) Master Mix with dye | ||
PCR Products | PCR Master Mixes | M3288 | FAST HotStart DNA Polymerase (2X) Master Mix with dye | ||
PCR Products | PCR Master Mixes | A120301 | Taq DNA Polymerase 1.1x Master Mix | ||
PCR Products | PCR Master Mixes | A370501 | Taq OptiMix CLEAR - 2-time PCR Master Mix | ||
PCR Products | PCR Master Mixes | A160301 | Taq DNA Polymerase 1.1x Master Mix Red | ||
PCR Products | PCR Master Mixes | A190301 | Taq DNA Polymerase Master Mix Red - 2mM MgCl2 | ||
PCR Products | PCR Master Mixes | A180303 | Taq DNA Polymerase Master Mix Red | ||
PCR Products | PCR Master Mixes | A230703 | TEMPase Hot Start Master Mix | ||
PCR Products | PCR Master Mixes | M3086 | IdentityPlant 2X Master Mix for direct PCR from plants | ||
PCR Products | PCR Master Mixes | M3120 | IdentityTaq 2X Master Mix for food of animal origin | ||
PCR Products | PCR Master Mixes | M3089 | IdentityTaq Kit 2X Master Mix for direct PCR from food of animal origin | ||
PCR Products | DNA Polymerases | M3001 | Taq DNA Polymerase S (high specificity) | ||
PCR Products | DNA Polymerases | M3043 | Taq DNA Polymerase E (high efficiency) | ||
PCR Products | DNA Polymerases | M3285 | FAST DNA Polymerase | ||
PCR Products | DNA Polymerases | M3287 | FAST HotStart DNA Polymerase | ||
PCR Products | DNA Polymerases | M3006 | HotStart Taq DNA Polymerase - Aptamer inhibited | ||
PCR Products | DNA Polymerases | M3307 | SuperHot Taq DNA Polymerase - chemically modified Hotstart Polymerase | ||
PCR Products | DNA Polymerases | M3306 | SuperHot Taq PCR Kit with dNTP mix | ||
PCR Products | DNA Polymerases | M3004 | Pfu Proofreading DNA Polymerase | ||
PCR Products | DNA Polymerases | M3002 | Pwo Proofreading DNA Polymerase | ||
PCR Products | DNA Polymerases | M3003 | ReproFast Proofreading Polymerase | ||
PCR Products | DNA Polymerases | M3012 | ReproHot Proofreading Polymerase | ||
PCR Products | DNA Polymerases | A767501 | AQ97 High Fidelity Proofreading Polymerase | ||
PCR Products | DNA Polymerases | M3185 | DF Taq Polymerase S (DNA-free) | ||
PCR Products | DNA Polymerases | M3008 | DF Taq Polymerase E (DNA free) | ||
PCR Products | DNA Polymerases | A101103 | Taq DNA Polymerase glycerol free | ||
PCR Products | DNA Polymerases | A110003 | Ampliqon Taq DNA Polymerase without Buffer | ||
PCR Products | DNA Polymerases | A112103 | Ampliqon Taq DNA Polymerase with Standard Buffer | ||
PCR Products | DNA Polymerases | A111103 | Ampliqon Taq DNA Polymerase with Ammonium Buffer | ||
PCR Products | DNA Polymerases | A223102 | TEMPase Hot Start DNA Polymerase | ||
PCR Products | dNTPs - Nucleotides | M3015 | dNTP-Set (Na salt) - 100mM | ||
PCR Products | dNTPs - Nucleotides | M3016 | dNTP Mix (Na salt) - 10mM | ||
PCR Products | dNTPs - Nucleotides | M3017 | ready to use PCR dNTP-Mix (Na-salt) - 2 Mm | ||
PCR Products | dNTPs - Nucleotides | M3428 | Biotin-11-dUTP Solution, min. 96% (1mM) | ||
PCR Products | dNTPs - Nucleotides | M3018 | dATP (2'-deoxyadenosine 5'-triphosphate) solution - 100 Mm | ||
PCR Products | dNTPs - Nucleotides | M3019 | dCTP solution - 100mM | ||
PCR Products | dNTPs - Nucleotides | M3020 | dGTP (2'-Deoxyguanosine 5'-triphosphate) solution - 100mM | ||
PCR Products | dNTPs - Nucleotides | M3021 | dTTP (2'-Deoxythymidine 5'-triphosphate) solution - 100mM | ||
PCR Products | dNTPs - Nucleotides | M3022 | dUTP solution 100mM | ||
PCR Products | dNTPs - Nucleotides | M3443 | 2',3'- Dideoxyadenosine-5'-O-triphosphate (ddATP) | ||
PCR Products | dNTPs - Nucleotides | M3444 | 2',3'- Dideoxycytidine-5'-O-triphosphate (ddCTP) | ||
PCR Products | dNTPs - Nucleotides | M3445 | 2',3'- Dideoxyguanosine-5'-O-triphosphate (ddGTP) | ||
PCR Products | dNTPs - Nucleotides | M3459 | 2',3'-Dideoxythymidine-5'-O-triphosphate (ddTTP) - 10mM solution | ||
PCR Products | PCR - Miscellaneous | M3096 | Uracil-DNA Glycosylase (UDG) | ||
PCR Products | PCR - Miscellaneous | M6340 | Nuclease and DNA-free Water for PCR not DEPC treated | ||
PCR Products | PCR - Miscellaneous | M6082 | Sterile nuclease-free DEPC Water | ||
PCR Products | PCR - Miscellaneous | M3039 | Oligo dT20 primer | ||
PCR Products | PCR - Miscellaneous | M3038 | Random Hexamer Primer N6 | ||
PCR Products | PCR - Miscellaneous | M3193 | SafeGel red stain for DNA electrophoresis | ||
PCR Products | PCR - Miscellaneous | M3217 | Green DNA Dye - 300 µl | ||
PCR Products | PCR - Miscellaneous | A351513 | ROX Passive Reference Dye - 600 µl | ||
PCR Products | PCR - Miscellaneous | M3041 | B-Enhancer solution | ||
PCR Products | PCR - Miscellaneous | M3308 | DNA Loading buffer I | ||
PCR Products | PCR - Miscellaneous | M3321 | DNA Loading buffer II with Orange G | ||
PCR Products | PCR - Miscellaneous | M3309 | Coral Red Buffer Dye solution (10X) | ||
PCR Products | PCR - Miscellaneous | M3458 | 5X PCR Buffer Red | ||
PCR Products | PCR - Miscellaneous | M3453 | 10X PCR Buffer S incomplete | ||
PCR Products | PCR - Miscellaneous | M3454 | 10X PCR Buffer S complete | ||
PCR Products | PCR - Miscellaneous | M3456 | 10X PCR Buffer E complete | ||
PCR Products | PCR - Miscellaneous | M3455 | 10X PCR Buffer E incomplete | ||
PCR Products | PCR - Miscellaneous | M3451 | 1mL 25mM MgCl2 solution for PCR | ||
PCR Products | PCR - Miscellaneous | M3373 | Custom made 10X PCR Buffer | ||
PCR Products | PCR - Miscellaneous | M3034 | Rnasin - recombinant RNase Inhibitor | ||
PCR Products | SNP Analysis | M3009 | SNP Pol DNA Polymerase | ||
PCR Products | SNP Analysis | M3061 | SNP Pol DNA Polymerase 2X PCR Mastermix | ||
PCR Products | SNP Analysis | M3025 | SNP PolTaq DNA Polymerase | ||
PCR Products | SNP Analysis | M3128 | SNP PolTaq DNA Polymerase 2X PCR Mastermix | ||
PCR Products | Simply Enlight PCR | M3236 | RedMasterMix Fluoro (2x) with gel staining dye | ||
PCR Products | Simply Enlight PCR | M3237 | GenLadder 100 bp Plus with gel staining dye | ||
PCR Products | Simply Enlight PCR | M3323 | DNA Loading buffer I Fluoro (6x) | ||
PCR Products | Simply Enlight PCR | M3234 | pBLooK™ LED Transilluminator | ||
RNA- DNA- Protein-Purification | S5318 | GENAzol - RNA Purification solution | |||
RNA- DNA- Protein-Purification | S5351 | PureIT ExoZAP - PCR Clean-Up reagent | |||
RNA- DNA- Protein-Purification | M3231 | Nucleic acid Extraction Solution | |||
RNA- DNA- Protein-Purification | A420025 | G2 DNA/RNA Extraction Enhancer Solution | |||
RNA- DNA- Protein-Purification | A420125 | 0.1mm Beads of G2 DNA/RNA Extraction Enhancer | |||
RNA- DNA- Protein-Purification | A421425 | 1.4mm Beads of G2 DNA/RNA Extraction Enhancer | |||
RNA- DNA- Protein-Purification | M6015 | Glycogen solution DNase-free - 20mg/Ml | |||
RNA- DNA- Protein-Purification | S5310 | Ceramic beads for tissue lysis | |||
RNA- DNA- Protein-Purification | S5391 | Co-NTA MagBeads for His-tagged protein purification | |||
RNA- DNA- Protein-Purification | S5356 | Co-NTA-Agarose for His-tagged proteins | |||
RNA- DNA- Protein-Purification | S5390 | Ni-NTA MagBeads for His-tagged protein purification | |||
RNA- DNA- Protein-Purification | S5377 | Ni-NTA Agarose for His-tagged proteins | |||
RNA- DNA- Protein-Purification | S5388 | Ni-IDA MagBeads for His-tagged protein purification | |||
RNA- DNA- Protein-Purification | S5353 | Ni-IDA Agarose for His-tagged proteins | |||
RNA- DNA- Protein-Purification | S5392 | Glutathione Magnetic Beads | |||
RNA- DNA- Protein-Purification | S5382 | Glutathione Agarose | |||
RNA- DNA- Protein-Purification | M3186 | Salmon Sperm DNA (Na salt) | |||
Molecular Biology | Agaroses | M3044 | Agarose LE - Standard Agarose | ||
Molecular Biology | Agaroses | M3054 | Agarose LE tablets | ||
Molecular Biology | Agaroses | M3049 | Agarose LM - low melting | ||
Molecular Biology | Agaroses | M3046 | Agarose Tiny - low melting, high resolution | ||
Molecular Biology | Agaroses | M3047 | Agarose Tiny HT high resolution, normal melting | ||
Molecular Biology | Agaroses | M3051 | Agarose Mega | ||
Molecular Biology | Electrophoresis | M3191 | SafeGel green stain for DNA electrophoresis | ||
Molecular Biology | Electrophoresis | M3199 | GelRed® in water - Nucleic acid stain | ||
Molecular Biology | Electrophoresis | M3179 | 0.07 % Ethidium bromide | ||
Molecular Biology | Electrophoresis | M3087 | TAE buffer (50X) ready-to-use solution | ||
Molecular Biology | Electrophoresis | M3085 | TAE buffer (10X) ready-to-use solution | ||
Molecular Biology | Electrophoresis | M3206 | TBE buffer (10X) ready-to-use solution | ||
Molecular Biology | Electrophoresis | M3088 | TBE buffer (10X) ready-to-use solution (MB-Grade) | ||
Molecular Biology | NGS | S5352 | NGS DNA Purification MagBeads | ||
Molecular Biology | NGS | M4400 | DNA Library Prep Kit for Illumina | ||
Molecular Biology | NGS | M4401 | DNA Library Prep Kit PLUS for Illumina | ||
Molecular Biology | DNA Marker / DNA Ladder | M3072 | GenLadder 50bp Plus (ready-to-use) with Orange G | ||
Molecular Biology | DNA Marker / DNA Ladder | GM3094 | GenLadder 100 bp Plus with loading dye | ||
Molecular Biology | DNA Marker / DNA Ladder | M3237 | GenLadder 100 bp Plus with gel staining dye | ||
Molecular Biology | DNA Marker / DNA Ladder | M3328 | GenLadder 1kb (ready-to-use) DNA marker | ||
Molecular Biology | DNA Marker / DNA Ladder | GM3084 | GenLadder XLarge up to 25 kbp - ready-to-use | ||
Molecular Biology | DNA Marker / DNA Ladder | M3080 | pBR322 - Hae III DNA marker | ||
Molecular Biology | DNA Marker / DNA Ladder | M3081 | pUC18/pUC19 (undigested) | ||
Molecular Biology | DNA Marker / DNA Ladder | M3073 | Lambda-DNA (undigested) | ||
Molecular Biology | Modifying Enzymes | M3036 | Proteinase K Powder | ||
Molecular Biology | Modifying Enzymes | M3037 | Proteinase K Solution (20mg/mL) | ||
Molecular Biology | Modifying Enzymes | M3116 | Proteinase Low-Temp - Solution (200 units/mL) | ||
Molecular Biology | Modifying Enzymes | M3028 | DNase I | ||
Molecular Biology | Modifying Enzymes | S5231 | Ribonuclease A (RNase A) | ||
Molecular Biology | Modifying Enzymes | S5218 | Ribonuclease A (RNase A) - DNase-free | ||
Molecular Biology | Modifying Enzymes | M3027 | T4 DNA-Ligase | ||
Cell Culture Media | C4030 | DMEM w/o L-glutamine, L-cystine, L-methionine, Glucose, Sodium pyruvate | |||
Cell Culture Media | C4150 | DMEM w/o L-glutamine, amino acids, with 1g/L Glucose | |||
Cell Culture Media | C4031 | DMEM with 1g/L Glucose, w/o L-glutamine, L-isoleucine | |||
Cell Culture Media | C4230 | DMEM w/o L-glutamine, L-arginine, L-lysine, Glucose, Sodium pyruvate | |||
Cell Culture Media | C4039 | DMEM for SILAC w/o L-glutamine, L-arginine, L-lysin, with 4.5g/L Glucose | |||
Cell Culture Media | C4117 | DMEM w/o L-cysteine, L-methionine, L-glutamine, with 4.5g/L Glucose | |||
Cell Culture Media | C4265 | DMEM w/o L-arginine, L-glutamine, with Sodium pyruvate, 4.5g/L Glucose | |||
Cell Culture Media | C4041 | DMEM w/o L-glutamine, NEAAs, with 4.5g/L Glucose | |||
Cell Culture Media | C4331 | DMEM with L-glutamine, 4.5g/L Glucose, w/o L-serine | |||
Cell Culture Media | C4332 | DMEM with L-glutamine, w/o Glucose, L-serine | |||
Cell Culture Media | C4353 | DMEM w/o L-glutamine, amino acids, with 4.5g/L Glucose | |||
Cell Culture Media | C4048 | DMEM w/o L-glutamine, L-arginine, L-lysin, L-methionine with 4.5g/L Glucose | |||
Cell Culture Media | C4359 | DMEM w/o L-glutamine, Sodium pyruvate, Phenol red with 4.5g/L Glucose | |||
Cell Culture Media | C4036 | DMEM with L-glutamine, 4,5g/L Glucose | |||
Cell Culture Media | C4024 | DMEM w/o L-glutamin, with 1.0g/L Glucose | |||
Cell Culture Media | C4324 | DMEM with stable glutamine, 1.0g/L Glucose | |||
Cell Culture Media | C4329 | DMEM with L-glutamine, 1.0g/L Glucose | |||
Cell Culture Media | C4027 | DMEM w/o L-glutamine, with 1.0g/L Glucose | |||
Cell Culture Media | C4028 | DMEM with stable glutamine, 4.5g/L Glucose | |||
Cell Culture Media | C4207 | DMEM with L-glutamine, 4.5g/L Glucose, w/o Phenol red | |||
Cell Culture Media | C4035 | DMEM w/o L-glutamine, with 4,5g/L Glucose | |||
Cell Culture Media | C4015 | DMEM:F12, 1:1 Mix w/o L-methionine, with HEPES | |||
Cell Culture Media | C4018 | DMEM:F12, 1:1 Mix w/o L-cystine, L-cysteine hydrochloride, L-methionine, with Glucose | |||
Cell Culture Media | C4020 | DMEM:F12, 1:1 Mix w/o Phenol red | |||
Cell Culture Media | C4016 | DMEM:F12, 1:1 Mix w/o amino acids, with Glucose | |||
Cell Culture Media | C4017 | DMEM:F12, 1:1 Mix with stable glutamine, HEPES | |||
Cell Culture Media | C4021 | DMEM:F12, 1:1 Mix with L-glutamine, w/o Glucose | |||
Cell Culture Media | C4022 | DMEM:F12, 1:1 Mix w/o L-glutamine, Glucose | |||
Cell Culture Media | C4029 | DMEM/F12, 1:1 Mix w/o L-glutamine, Glucose, with Sodium pyruvate | |||
Cell Culture Media | C4046 | DMEM:F12, 1:1 Mix with stable glutamine | |||
Cell Culture Media | C4023 | DMEM:F12, 1:1 Mix with L-glutamine, 15mM HEPES | |||
Cell Culture Media | C4071 | DMEM:F12, 1:1 Mix with stable glutamine, HEPES | |||
Cell Culture Media | C4068 | DMEM/F12, 1:1 Mix with stable glutamine, Glucose | |||
Cell Culture Media | C4099 | RPMI 1640 w/o L-cystine, L-methionine | |||
Cell Culture Media | C4102 | RPMI 1640 with 20mM Hepes, stab. glutamine, 1mM Sodium pyruvate, NEAAs | |||
Cell Culture Media | C4115 | RPMI 1640 w/o amino acids, folic acid | |||
Cell Culture Media | C4110 | RPMI 1640, with L-glutamine, 110mg/L pyruvate | |||
Cell Culture Media | C4111 | RPMI 1640 w/o Ca, L-glutamine | |||
Cell Culture Media | C4112 | RPMI 1640 w/o L-glutamine, L-isoleucine | |||
Cell Culture Media | C4113 | RPMI 1640 w/o Glucose, L-glutamine | |||
Cell Culture Media | C4114 | RPMI 1640 with L-glutamine, w/o Glucose | |||
Cell Culture Media | C4116 | RPMI 1640 with stab. glutamine, w/o Phenol red, Glucose | |||
Cell Culture Media | C4095 | RPMI 1640 with L-glutamine | |||
Cell Culture Media | C4106 | RPMI 1640 with L-glutamine, 25mM Hepes | |||
Cell Culture Media | C4107 | RPMI 1640 with stable glutamine, 25mM Hepes | |||
Cell Culture Media | C4081 | MEM Eagle with Earle´s BSS w/o L-glutamine, NaHCO3 | |||
Cell Culture Media | C4082 | MEM Eagle with Earle´s BSS w/o L-glutamine, NaHCO3, with 20mM Hepes | |||
Cell Culture Media | C4087 | MEM Eagle with Earle´s BSS with D-Valine, w/o L-glutamine | |||
Cell Culture Media | C4093 | MEM Eagle with Hank´s BSS with L-glutamine, 0.60g/L NaHCO3 | |||
Cell Culture Media | C4330 | MEM Eagle with Earle´s BSS w/o L-glutamine, Phenol red | |||
Cell Culture Media | C4080 | MEM Eagle with Earle´s BSS with L-glutamine, 20mM Hepes | |||
Cell Culture Media | C4042 | EMEM optimized for Fibroblasts, w/o L-glutamine | |||
Cell Culture Media | C4275 | Alpha MEM Eagle with nucleosides, with L-glutamine, w/o Glucose | |||
Cell Culture Media | C4077 | Alpha MEM Eagle w/o Nucleosides, L-arginine, L-lysine | |||
Cell Culture Media | C4323 | Alpha MEM Eagle w/o L-glutamine, Nucleosides | |||
Cell Culture Media | C4007 | Alpha MEM Eagle with Nucleosides, w/o amino acids | |||
Cell Culture Media | C4276 | Alpha MEM Eagle with Nucleosides, L-glutamine, Glucose | |||
Cell Culture Media | C4006 | Alpha MEM Eagle w/o Nucleosides, with L-gluamine, with Glucose | |||
Cell Culture Media | C4003 | Alpha MEM Eagle with Nucleosides, L-glutamine, Glucose | |||
Cell Culture Media | C4047 | Ham´s F-10 Medium w/o L-glutamine, Phenol red | |||
Cell Culture Media | C4050 | Ham´s F-10 Medium with stable glutamine, w/o Phenol red | |||
Cell Culture Media | C4278 | Ham´s F-10 Medium w/o L-glutamine | |||
Cell Culture Media | C4322 | Ham´s F-12 Medium w/o L-glutamine, with 2.5g/L NaHCO3 | |||
Cell Culture Media | C4271 | Ham´s F-12 Medium with L-glutamine, w/o Phenol red | |||
Cell Culture Media | C4054 | Ham´s F-12 Medium w/o folic acid | |||
Cell Culture Media | C4053 | Ham´s F-12 Medium with stable glutamine | |||
Cell Culture Media | C4268 | McCoy´s 5A Medium (Modified) w/o L-glutamine, Phenol red | |||
Cell Culture Media | C4269 | McCoy´s 5A Medium (Modified) with L-glutamine, w/o Phenol red | |||
Cell Culture Media | C4065 | McCoy´s 5A Medium (Modified) with L-glutamine | |||
Cell Culture Media | C4354 | Leibovitz´s L-15 Medium w/o L-glutamine, NaHCO3 | |||
Cell Culture Media | C4360 | Leibovitz´s L-15 Medium with L-glutamine, 2.0g/L NaHCO3 | |||
Cell Culture Media | C4074 | Medium 199 with Earle´s BSS w/o L-glutamine, phenol red, with 25 mM Hepes | |||
Cell Culture Media | C4266 | Medium 199 with Hank´s BSS, 15mM Hepes | |||
Cell Culture Media | C4070 | Medium 199 with Earle´s BSS w/o L-glutamine, with 0.35 g/L NaHCO3 | |||
Cell Culture Media | C4069 | Medium 199 with Earle´s BSS w/o L-glutamine | |||
Cell Culture Media | C4272 | Iscove´s Modified Dulbecco´s Medium with stable glutamine, 25 mM Hepes, w/o Phenol red | |||
Cell Culture Media | C4056 | Iscove´s Modified Dulbecco´s Medium w/o L-glutamine, with 20 mM Hepes | |||
Cell Culture Media | C4058 | Iscove´s Modified Dulbecco´s Medium w/o L-glutamin, with 25 mM Hepes | |||
Cell Culture Media | C4057 | Iscove´s Modified Dulbecco´s Medium with L-glutamin, 25 mM Hepes | |||
Cell Culture Media | C4044 | Glasgow-MEM (BHK 21) with L-glutamine, Tryptose phosphate | |||
Cell Culture Media | C4767 | Glasgow-MEM (BHK 21) powder w/o L-glutamine, Tryptose phosphate | |||
Cell Culture Media | C4043 | Glasgow-MEM (BHK 21) with L-glutamine, Tryptose phosphate | |||
Cell Culture Media | C4045 | Glasgow-MEM (BHK 21) w/o L-glutamine, Tryptose phosphate | |||
Cell Culture Media | C4318 | William´s Medium E w/o L-glutamine, Glucose, Phenol red | |||
Cell Culture Media | C4312 | William´s Medium E with stab. Glutamine, w/o Phenol Red | |||
Cell Culture Media | C4317 | William´s Medium E w/o L-glutamine, Glucose | |||
Cell Culture Media | C4319 | William´s Medium E w/o L-glutamine, Glucose, Sodium pyruvate | |||
Cell Culture Media | C4121 | William´s Medium E w/o L-glutamine, Phenol red | |||
Cell Culture Media | C4316 | William´s Medium E with stab. glutamine | |||
Cell Culture Media | C4274 | Basal Medium (Eagle) with EBSS, w/o Phenol red | |||
Cell Culture Media | C4009 | Basal Medium (Eagle) with EBSS w/o NaHCO3 | |||
Cell Culture Media | C4012 | Basal Medium (Eagle) with EBSS, w/o L-glutamine | |||
Cell Culture Media | C4756 | CMRL-1066 with L-glutamine | |||
Cell Culture Media | C4755 | CMRL-1066 w/o L-glutamine, Phenol red | |||
Cell Culture Media | C4277 | Schneider´s Drosophila Medium w/o L-glutamine, L-methionine | |||
Cell Culture Media | C4192 | Schneider´s Drosophila Medium w/o L-glutamine | |||
Cell Culture Media | C4193 | Schneider´s Drosophila Medium with L-glutamine | |||
Cell Culture Media | C4195 | TC-100 Insect Medium w/o L-glutamine | |||
Cell Culture Media | C4194 | TC-100 Insect Medium with L-glutamine | |||
Cell Culture Media | C4296 | TC-100 Insect Medium w/o L-glutamine, L-methionine | |||
Cell Culture Media | C4190 | IPL-41 Insect Medium w/o L-glutamine | |||
Cell Culture Media | C4311 | IPL-41 Insect Medium with L-glutamine | |||
Cell Culture Media | C4765 | IPL-41 Insect Medium w/o L-glutamine | |||
Cell Culture Media | C4191 | TNM-FH Insect-Medium Special | |||
Cell Culture Media | C4299 | TNM-FH Insect-Medium with FBS | |||
Cell Culture Media | C4188 | Grace´ Insect Medium w/o L-glutamine | |||
Cell Culture Media | C4338 | Insect Profree - Sf9 / Sf21 | |||
Cell Culture Media | C4153 | ISF-1 Medium for Hybridoma | |||
Cell Culture Media | C4206 | Serafree 293-FS serum free medium for HEK cells | |||
Cell Culture Media | C4369 | Serum Replacement NTA | |||
Cell Culture Reagents | Antibiotics | M3448 | Amoxicillin trihydrate | ||
Cell Culture Reagents | Antibiotics | M3122 | Gentamycin sulfate solution | ||
Cell Culture Reagents | Antibiotics | M3109 | Amphotericin B solution | ||
Cell Culture Reagents | Antibiotics | M3108 | Amphotericin B powder | ||
Cell Culture Reagents | Antibiotics | M3218 | Antibiotic Antimycotic Solution (100X) | ||
Cell Culture Reagents | Antibiotics | M3450 | Apramycin sulfate | ||
Cell Culture Reagents | Antibiotics | M3111 | Bacitracin powder, min. 55 IU/mg | ||
Cell Culture Reagents | Antibiotics | M3112 | Bleomycin sulfate, lyophil. Pure | ||
Cell Culture Reagents | Antibiotics | M3147 | Doxycycline Hyclat | ||
Cell Culture Reagents | Antibiotics | M3118 | G418 - 50mg/Ml | ||
Cell Culture Reagents | Antibiotics | M3117 | G418 powder | ||
Cell Culture Reagents | Antibiotics | M3121 | Gentamycin sulfate powder | ||
Cell Culture Reagents | Antibiotics | M3126 | Hygromycin B solution - 50mg/Ml | ||
Cell Culture Reagents | Antibiotics | M3226 | Isoniazid | ||
Cell Culture Reagents | Antibiotics | M3132 | Kanamycin sulfate 50 mg/Ml | ||
Cell Culture Reagents | Antibiotics | M3131 | Kanamycin sulfate 10 mg/Ml | ||
Cell Culture Reagents | Antibiotics | M3140 | Penicillin-Streptomycin (10000 U/mL) | ||
Cell Culture Reagents | Antibiotics | M3429 | Phleomycin powder | ||
Cell Culture Reagents | Antibiotics | M3227 | Pyrazinecarboxamide | ||
Cell Culture Reagents | Antibiotics | M3145 | Spectinomycin dihydrochloride pentahydrate | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4289 | 0.05% Trypsin in PBS with 0.02% EDTA, with Phenol red, w/o Mg2+, Ca2+ | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4260 | 0.05% Trypsin in PBS with 0.02% EDTA, w/o Mg2+, Ca2+ | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4261 | 0.05% Trypsin and 0.1% EDTA in PBS w/o Mg2+, Ca2+, w/o Phenol red | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4288 | 0.25% Trypsin in HBSS with 1mM EDTA, w/o Mg and Ca, with Phenol red | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4267 | 0.25% Trypsin in PBS with 0.02% EDTA | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4259 | 0.25% Trypsin in PBS w/o Mg and Ca | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4262 | 0.25% Trypsin in PBS with 0.02% EDTA with Phenol red | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4261 | 0.5% Trypsin in PBS with 0.2% EDTA - 10X solution | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4287 | 2.5% Trypsin in PBS (10X) | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4356 | Accutase® Cell Detachment Solution | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4255 | Collagenase Type I (EC 3.4.24.3) >100 units/mg | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4341 | Collagenase Type II (EC 3.4.24.3) >180 units/mg | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4346 | Collagenase Type III (EC 3.4.24.3) | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4310 | Collagenase Type IV (EC 3.4.24.3) >900 units/mg | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4263 | PBS 5x with 1% EDTA without Ca2+ and Mg2+ | ||
Cell Culture Reagents | Cell Dissociation Reagents | M6077 | Trypsin from bovine pancreas | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4264 | Trypsin powder from porcine pancreas (1:250) | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4352 | Zymolyase(R) -20T | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4366 | Zymolyase(R) -100T | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4281 | 200 mM L-glutamine (100 X) | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4297 | Stable Glutamine | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4309 | Thymidine (2-Deoxythymidine) | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4284 | MEM Amino Acids Solution (50X) | ||
Cell Culture Reagents | Cell Dissociation Reagents | C4368 | Serum Replacement Basic | ||
Cell Culture Reagents | Cell Separation Reagents | M3207 | Caesium chloride (99.9 %) | ||
Cell Culture Reagents | Cell Separation Reagents | M3209 | Ficoll(R) 400 - Polysucrose 400 | ||
Cell Culture Reagents | Cell Separation Reagents | C4432 | LEUCO-Human - Cell separation medium | ||
Cell Culture Reagents | Cell Separation Reagents | C4435 | LEUCO-Mouse - Cell separation medium | ||
Cell Culture Reagents | Cell Separation Reagents | C4754 | Lympho-Paque - Cell separation medium | ||
Balanced Salt Solutions | Buffer | C4217 | Dulbecco's PBS solution with Ca and Mg, w/o NaHCO3 | ||
Balanced Salt Solutions | Buffer | C4219 | Dulbecco's PBS solution w/o Mg, Ca, NaHCO3 | ||
Balanced Salt Solutions | Buffer | C4218 | PBS solution w/o NaHCO3 (10X) | ||
Balanced Salt Solutions | Buffer | C4220 | PBS solution w/o Mg, Ca, NaHCO3 (10X) | ||
Balanced Salt Solutions | Buffer | M6081 | Sterile Cell Culture Grade Water | ||
Biochemicals | Buffers | M6378 | BES | ||
Biochemicals | Buffers | M6362 | Bicine | ||
Biochemicals | Buffers | M6347 | Bis-Tris | ||
Biochemicals | Buffers | M6200 | CAPS | ||
Biochemicals | Buffers | M6258 | CHAPS | ||
Biochemicals | Buffers | M6202 | CHAPSO | ||
Biochemicals | Buffers | M6203 | CHES | ||
Biochemicals | Buffers | M6370 | Hepes | ||
Biochemicals | Buffers | M6033 | Imidazole | ||
Biochemicals | Buffers | M6207 | MES | ||
Biochemicals | Buffers | M6257 | MOPS | ||
Biochemicals | Buffers | M6209 | PIPES | ||
Biochemicals | Buffers | M6208 | TAPS | ||
Biochemicals | Buffers | M6215 | Tris base | ||
Biochemicals | Buffers | M3292 | SDS Solution, 20% | ||
Biochemicals | Buffers | M3315 | SDS Solution, 5% | ||
Biochemicals | Buffers | M3098 | TE buffer (1X) / Tris-EDTA buffer - pH7.5 | ||
Biochemicals | Buffers | M3091 | TE buffer (1X) / Tris-EDTA buffer - pH8.0 | ||
Biochemicals | Buffers | D2008 | Carbonate-Bicarbonate buffer tablets (pH9.6) | ||
Biochemicals | Buffers | D2009 | Carbonate-Bicarbonate buffer tablets with Azide (pH9.6) | ||
Biochemicals | Buffers | D2002 | PBS buffer tablets | ||
Biochemicals | Buffers | D2038 | TBS with Tween 20, pH7.6 | ||
Biochemicals | Buffers | M3171 | Tween 20 | ||
Biochemicals | Buffers | M3173 | Tween 80 | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5047 | D(+)-Fucose | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5050 | D-Galactosamine x HCl | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5049 | D(+)-Galactose | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5192 | D.(+)-Galacturonic acid | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5056 | L-Glucose | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6045 | Glycogen | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5058 | Hyaluronic acid | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5066 | Lactulose | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5073 | D-Mannose | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5069 | D(+)-Maltose | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5091 | D-Raffinose pentahydrate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5092 | L-Rhamnose monohydrate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5115 | D(+)-Trehalose dihydrate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5122 | D-Xylulose | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6059 | Polyethylene glycol 400 - PEG 400 | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6060 | Polyethylene glycol 1000 - PEG 1000 | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3167 | Polyethylene glycol 4000 - PEG 4000 | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3168 | Polyethylene glycol 6000 - PEG 6000 | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6061 | Polyethylene glycol 8000 - PEG 8000 | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5152 | n-Tridecyl-ß-maltopyranoside (TDM) | ||
Biochemicals | Carbohydrates / Detergents / Substrates | D2010 | p-Nitrophenylphosphate tablets | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3158 | 3,3'5,5'-Tetramethylbenzidine (TMB) | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3338 | 4-Chloro-1-Naphthol | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3210 | Acetyl Coenzyme A (>83% enzymatic) | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3219 | Coenzyme A trilithium salt (>93%) | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3196 | BCIP | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3225 | Bluo-Gal / 5-Bromo-3-indolyl-beta-D-galactopyranoside | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3224 | D-Glucose-6-phosphate disodium | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3197 | IPTG, dioxane free | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S4100 | D-Luciferin potassium salt | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6058 | NADPH (tetrasodium salt) | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6057 | Nicotinamide adenine dinculeotide phosphate - NADP | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6056 | NADH, Nicotinamide adenine dinucleotide | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6055 | beta-Nicotinamide adenine dinucleotide - beta-NAD | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3223 | Naphthol-AS-D-chloroacetate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3202 | Naphthol-AS-BI-phosphate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3203 | Nitro Blue Tetrazolium Chloride | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3163 | Spermine tetrahydrochloride | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3195 | Thiazolyl blue tetrazolium bromide (MTT) | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3204 | X-Gal / 5-Bromo-4-chloro-3-indolyl-b-D-galactopyranoside | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3162 | Putrescine dihydrochloride | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3205 | X-β-D-Glucoside / X-Glu / X-Gluc | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5437 | Collagenase-Chromophore-Substrate Component A | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6213 | Calcium lactate pentahydrate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M3275 | Citric acid trisodium salt dihydrate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5331 | Prestained Protein Marker - 10-245 kDa | ||
Biochemicals | Carbohydrates / Detergents / Substrates | S5332 | Prestained Protein Marker - 10-180 kDa | ||
Biochemicals | Carbohydrates / Detergents / Substrates | C4339 | Gelatin, powder | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6051 | Guanidine thiocyanate | ||
Biochemicals | Carbohydrates / Detergents / Substrates | M6046 | Guanidine hydrochloride | ||
Biochemicals | Solvents | M6323 | DMSO, Cell culture grade | ||
Biochemicals | Solvents | M6324 | DMSO, Molecular biology grade | ||
Biochemicals | Solvents | M6325 | DMSO, p. A. | ||
Biochemicals | Solvents | M6023 | Diethylene glycol | ||
Biochemicals | Solvents | M6029 | Ethylene glycol | ||
Biochemicals | Solvents | M6080 | Cleaning solution | ||
Biochemicals | Dyes / Stains | M3199 | GelRed in water - Nucleic acid stain | ||
Biochemicals | Dyes / Stains | M3193 | SafeGel red stain | ||
Biochemicals | Dyes / Stains | M3191 | SafeGel green stain | ||
Biochemicals | Dyes / Stains | M3320 | Fast Blue B salt | ||
Biochemicals | Dyes / Stains | M3176 | DAPI - 4',6-Diamidino-2-phenylindole dihydrochloride | ||
Biochemicals | Dyes / Stains | M3181 | Propidium iodide | ||
Biochemicals | Dyes / Stains | M3312 | Xylene Cyanol FF | ||
Biochemicals | Dyes / Stains | M3179 | Ethidium bromide | ||
Biochemicals | Dyes / Stains | M3350 | Ponceau S Solution | ||
Biochemicals | Dyes / Stains | M3180 | Orange G | ||
Biochemicals | Dyes / Stains | A351513 | ROX Passive Reference Dye | ||
Biochemicals | Dyes / Stains | M3217 | Green DNA Dye | ||
Peptides & Proteins | Peptides | P2784 | Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein) | ||
Peptides & Proteins | Peptides | P2782 | Epsilon Variant (B.1.427/B.1.429) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) | ||
Peptides & Proteins | Peptides | P2783 | Eta Variant (B.1.525) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) | ||
Peptides & Proteins | Peptides | P2781 | Omicron Variant B.1.1.529 Peptide Pool SARS-CoV-2 (Spike Glycoprotein) | ||
Peptides & Proteins | Peptides | P2780 | Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein) | ||
Peptides & Proteins | Peptides | P4016 | Variant B.1.617.1 (Kappa ) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) | ||
Peptides & Proteins | Peptides | P4014 | SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides | ||
Peptides & Proteins | Peptides | P4013 | Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein) | ||
Peptides & Proteins | Peptides | P4012 | SARS-CoV-2 Surface GP_1 A3 (378-386) - KCYGVSPTK | ||
Peptides & Proteins | Peptides | P4011 | SARS-CoV-2 Surface GP_1 A1 (865-873) - LTDEMIAQY | ||
Peptides & Proteins | Peptides | P4010 | SARS-CoV-2 Surface GP A2 (1000-1008) - YLQPRTFLL | ||
Peptides & Proteins | Peptides | P4009 | SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT | ||
Peptides & Proteins | Peptides | P4008 | SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL | ||
Peptides & Proteins | Peptides | P4007 | SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI | ||
Peptides & Proteins | Peptides | P4006 | SARS-CoV-2 Nucleocapsid A2 (N223-231) LLLDRLNQL | ||
Peptides & Proteins | Peptides | P4005 | SARS-CoV-2 Membrane GP A2 (61-70) TLACFVLAAV | ||
Peptides & Proteins | Peptides | P4004 | SARS-CoV-2 Nucleocapsid A2 (226-234) LALLLLDRL | ||
Peptides & Proteins | Peptides | P4003 | SARS-CoV-2 Nucleocapsid A2 (219-227) LQLPQGTTL | ||
Peptides & Proteins | Peptides | P4002 | SARS-CoV-2 Nucleocapsid A2 (316-324) GMSRIGMEV | ||
Peptides & Proteins | Peptides | P4001 | SARS-CoV-2 Nucleocapsid A2 (138-146) - ALNTPKDHI | ||
Peptides & Proteins | Peptides | P4000 | SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL | ||
Peptides & Proteins | Bioactive Proteins | P2293 | FLAG-Peptide - DYKDDDDK | ||
Peptides & Proteins | Bioactive Proteins | P2300 | 3x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK | ||
Peptides & Proteins | Bioactive Proteins | P2299 | human LL-37 [LL-37, 37 aa] | ||
Peptides & Proteins | Bioactive Proteins | P2955 | human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR | ||
Peptides & Proteins | Bioactive Proteins | M3105 | Albumin from hen egg white - Ovalbumin | ||
Peptides & Proteins | Bioactive Proteins | M3177 | Ovalbumin (crude) | ||
Peptides & Proteins | Bioactive Proteins | M3100 | Bovine albumin crystallized, free of fatty acid, free of globulin | ||
Peptides & Proteins | Bioactive Proteins | M3103 | Bovine albumin Fraction V (pH 7.0) | ||
Peptides & Proteins | Bioactive Proteins | M3101 | Bovine albumin for EIA and RIA | ||
Peptides & Proteins | Bioactive Proteins | M3104 | Bovine Serum Albumin, very low endotoxin, no IgG |