Türkiye Yetkili Distribütörü olduğumuz markalarımızMARKALARIMIZ

Genaxxon bioscience GmbH, 22 yılı aşkın süredir güvenilir bir ortak olmuştur. Özel ekibi ile yalnızca birinci sınıf ürünler sunmakla kalmıyor, aynı zamanda laboratuvar çalışmalarınızı optimize etmek için kişisel iletişim ve hızlı teknik destek de sunuyor.

ISO 9001:2015 sertifikalı bir şirket olarak, 20 yılı aşkın süredir müşterilerimizin PCR, RT-PCR ve gerçek zamanlı PCR’yi (qPCR) güvenilir ve tekrarlanabilir hale getiren yüksek kaliteli moleküler biyoloji ürünlerinden oluşan geniş bir portföy sunmaktadır.

Ayrıca yetkin Genaxxon ekibi, Müşteriye özel hücre kültürü besi yeri veya özel ambalaj miktarları gibi özelleştirilmiş ürünlere yönelik özel taleplerde bile destek sağlıyor ve soruları hızlı ve doğrudan yanıtlıyor.

Genaxxon, biyobilimi sürdürülebilir bir şekilde üretim ve ticaret yapmaktadır. Almanya’daki üretimleri sayesinde kısa mesafeler, çevre dostu ambalaj malzemeleri ve CO2 nötr nakliye, en başından beri yüksek bir öncelik olmuştur.

Ürün Kategorileri

  • PCR Ürünleri
    PCR kimyasalları
  • RNA DNA Protein Saflaştırma
    Agaroz
  • Moleküler Biyoloji
    Agaroz
  • Hücre Kültürü Ortamı
    Hücre kültürü besiyerleri (Dmem F12, F12K, Alpha Mem),
  • Hücre Kültürü Reaktifleri
    Collagenase çeşitleri
  • Buffer
  • Biyokimyasal
    Ethidium Bromide, DMSO
  • Peptitler ve Proteinler

Kataloglar

İçerik henüz mevcut değil.

Ürün Listesi
KategoriAlt kategoriÜrün kategorisiÜrün alt kategorisiKodAçıklama
PCR ProductsPCR Master MixesM3014PCR Master Mix (2X)
PCR ProductsPCR Master MixesM3007SuperHot Master Mix (2-times)
PCR ProductsPCR Master MixesM3029RedMasterMix (2x) - PCR Master Mix with red dye
PCR ProductsPCR Master MixesM3221RedMastermix Hot (2x) Hotstart Master Mix with red dye
PCR ProductsPCR Master MixesM3007bSuperHot Master Mix Blue (2X)
PCR ProductsPCR Master MixesA770101AQ97 High Fidelity Master Mix 2X
PCR ProductsPCR Master MixesA790801AQ97 Hot Start High Fidelity PCR 2x Master Mix
PCR ProductsPCR Master MixesM30245X qPCR Multiplex Master Mix
PCR ProductsPCR Master MixesM3013Multiplex HS Master Mix (2X)
PCR ProductsPCR Master MixesM3026Lyophilized 5x qPCR Multiplex Master Mix
PCR ProductsPCR Master MixesM3071LyoMix - Lyophilized qPCR Probe Master Mix powder
PCR ProductsPCR Master MixesM3069LyoBalls - Lyophilized qPCR Master Mix - pre-dispensed (0.1mL wells)
PCR ProductsPCR Master MixesM3070LyoBalls - Lyophilized qPCR Master Mix - pre-dispensed
PCR ProductsPCR Master MixesM3005LyoPlex Multiplex PCR Master Mix - lyophilized
PCR ProductsPCR Master MixesM3286FAST DNA Polymerase (2X) Master Mix with dye
PCR ProductsPCR Master MixesM3288FAST HotStart DNA Polymerase (2X) Master Mix with dye
PCR ProductsPCR Master MixesA120301Taq DNA Polymerase 1.1x Master Mix
PCR ProductsPCR Master MixesA370501Taq OptiMix CLEAR - 2-time PCR Master Mix
PCR ProductsPCR Master MixesA160301Taq DNA Polymerase 1.1x Master Mix Red
PCR ProductsPCR Master MixesA190301Taq DNA Polymerase Master Mix Red - 2mM MgCl2
PCR ProductsPCR Master MixesA180303Taq DNA Polymerase Master Mix Red
PCR ProductsPCR Master MixesA230703TEMPase Hot Start Master Mix
PCR ProductsPCR Master MixesM3086IdentityPlant 2X Master Mix for direct PCR from plants
PCR ProductsPCR Master MixesM3120IdentityTaq 2X Master Mix for food of animal origin
PCR ProductsPCR Master MixesM3089IdentityTaq Kit 2X Master Mix for direct PCR from food of animal origin
PCR ProductsDNA PolymerasesM3001Taq DNA Polymerase S (high specificity)
PCR ProductsDNA PolymerasesM3043Taq DNA Polymerase E (high efficiency)
PCR ProductsDNA PolymerasesM3285FAST DNA Polymerase
PCR ProductsDNA PolymerasesM3287FAST HotStart DNA Polymerase
PCR ProductsDNA PolymerasesM3006HotStart Taq DNA Polymerase - Aptamer inhibited
PCR ProductsDNA PolymerasesM3307SuperHot Taq DNA Polymerase - chemically modified Hotstart Polymerase
PCR ProductsDNA PolymerasesM3306SuperHot Taq PCR Kit with dNTP mix
PCR ProductsDNA PolymerasesM3004Pfu Proofreading DNA Polymerase
PCR ProductsDNA PolymerasesM3002Pwo Proofreading DNA Polymerase
PCR ProductsDNA PolymerasesM3003ReproFast Proofreading Polymerase
PCR ProductsDNA PolymerasesM3012ReproHot Proofreading Polymerase
PCR ProductsDNA PolymerasesA767501AQ97 High Fidelity Proofreading Polymerase
PCR ProductsDNA PolymerasesM3185DF Taq Polymerase S (DNA-free)
PCR ProductsDNA PolymerasesM3008DF Taq Polymerase E (DNA free)
PCR ProductsDNA PolymerasesA101103Taq DNA Polymerase glycerol free
PCR ProductsDNA PolymerasesA110003Ampliqon Taq DNA Polymerase without Buffer
PCR ProductsDNA PolymerasesA112103Ampliqon Taq DNA Polymerase with Standard Buffer
PCR ProductsDNA PolymerasesA111103Ampliqon Taq DNA Polymerase with Ammonium Buffer
PCR ProductsDNA PolymerasesA223102TEMPase Hot Start DNA Polymerase
PCR ProductsdNTPs - NucleotidesM3015dNTP-Set (Na salt) - 100mM
PCR ProductsdNTPs - NucleotidesM3016dNTP Mix (Na salt) - 10mM
PCR ProductsdNTPs - NucleotidesM3017ready to use PCR dNTP-Mix (Na-salt) - 2 Mm
PCR ProductsdNTPs - NucleotidesM3428Biotin-11-dUTP Solution, min. 96% (1mM)
PCR ProductsdNTPs - NucleotidesM3018dATP (2'-deoxyadenosine 5'-triphosphate) solution - 100 Mm
PCR ProductsdNTPs - NucleotidesM3019dCTP solution - 100mM
PCR ProductsdNTPs - NucleotidesM3020dGTP (2'-Deoxyguanosine 5'-triphosphate) solution - 100mM
PCR ProductsdNTPs - NucleotidesM3021dTTP (2'-Deoxythymidine 5'-triphosphate) solution - 100mM
PCR ProductsdNTPs - NucleotidesM3022dUTP solution 100mM
PCR ProductsdNTPs - NucleotidesM34432',3'- Dideoxyadenosine-5'-O-triphosphate (ddATP)
PCR ProductsdNTPs - NucleotidesM34442',3'- Dideoxycytidine-5'-O-triphosphate (ddCTP)
PCR ProductsdNTPs - NucleotidesM34452',3'- Dideoxyguanosine-5'-O-triphosphate (ddGTP)
PCR ProductsdNTPs - NucleotidesM34592',3'-Dideoxythymidine-5'-O-triphosphate (ddTTP) - 10mM solution
PCR ProductsPCR - MiscellaneousM3096Uracil-DNA Glycosylase (UDG)
PCR ProductsPCR - MiscellaneousM6340Nuclease and DNA-free Water for PCR not DEPC treated
PCR ProductsPCR - MiscellaneousM6082Sterile nuclease-free DEPC Water
PCR ProductsPCR - MiscellaneousM3039Oligo dT20 primer
PCR ProductsPCR - MiscellaneousM3038Random Hexamer Primer N6
PCR ProductsPCR - MiscellaneousM3193SafeGel red stain for DNA electrophoresis
PCR ProductsPCR - MiscellaneousM3217Green DNA Dye - 300 µl
PCR ProductsPCR - MiscellaneousA351513ROX Passive Reference Dye - 600 µl
PCR ProductsPCR - MiscellaneousM3041B-Enhancer solution
PCR ProductsPCR - MiscellaneousM3308DNA Loading buffer I
PCR ProductsPCR - MiscellaneousM3321DNA Loading buffer II with Orange G
PCR ProductsPCR - MiscellaneousM3309Coral Red Buffer Dye solution (10X)
PCR ProductsPCR - MiscellaneousM34585X PCR Buffer Red
PCR ProductsPCR - MiscellaneousM345310X PCR Buffer S incomplete
PCR ProductsPCR - MiscellaneousM345410X PCR Buffer S complete
PCR ProductsPCR - MiscellaneousM345610X PCR Buffer E complete
PCR ProductsPCR - MiscellaneousM345510X PCR Buffer E incomplete
PCR ProductsPCR - MiscellaneousM34511mL 25mM MgCl2 solution for PCR
PCR ProductsPCR - MiscellaneousM3373Custom made 10X PCR Buffer
PCR ProductsPCR - MiscellaneousM3034Rnasin - recombinant RNase Inhibitor
PCR ProductsSNP AnalysisM3009SNP Pol DNA Polymerase
PCR ProductsSNP AnalysisM3061SNP Pol DNA Polymerase 2X PCR Mastermix
PCR ProductsSNP AnalysisM3025SNP PolTaq DNA Polymerase
PCR ProductsSNP AnalysisM3128SNP PolTaq DNA Polymerase 2X PCR Mastermix
PCR ProductsSimply Enlight PCRM3236RedMasterMix Fluoro (2x) with gel staining dye
PCR ProductsSimply Enlight PCRM3237GenLadder 100 bp Plus with gel staining dye
PCR ProductsSimply Enlight PCRM3323DNA Loading buffer I Fluoro (6x)
PCR ProductsSimply Enlight PCRM3234pBLooK™ LED Transilluminator
RNA- DNA- Protein-PurificationS5318GENAzol - RNA Purification solution
RNA- DNA- Protein-PurificationS5351PureIT ExoZAP - PCR Clean-Up reagent
RNA- DNA- Protein-PurificationM3231Nucleic acid Extraction Solution
RNA- DNA- Protein-PurificationA420025G2 DNA/RNA Extraction Enhancer Solution
RNA- DNA- Protein-PurificationA4201250.1mm Beads of G2 DNA/RNA Extraction Enhancer
RNA- DNA- Protein-PurificationA4214251.4mm Beads of G2 DNA/RNA Extraction Enhancer
RNA- DNA- Protein-PurificationM6015Glycogen solution DNase-free - 20mg/Ml
RNA- DNA- Protein-PurificationS5310Ceramic beads for tissue lysis
RNA- DNA- Protein-PurificationS5391Co-NTA MagBeads for His-tagged protein purification
RNA- DNA- Protein-PurificationS5356Co-NTA-Agarose for His-tagged proteins
RNA- DNA- Protein-PurificationS5390Ni-NTA MagBeads for His-tagged protein purification
RNA- DNA- Protein-PurificationS5377Ni-NTA Agarose for His-tagged proteins
RNA- DNA- Protein-PurificationS5388Ni-IDA MagBeads for His-tagged protein purification
RNA- DNA- Protein-PurificationS5353Ni-IDA Agarose for His-tagged proteins
RNA- DNA- Protein-PurificationS5392Glutathione Magnetic Beads
RNA- DNA- Protein-PurificationS5382Glutathione Agarose
RNA- DNA- Protein-PurificationM3186Salmon Sperm DNA (Na salt)
Molecular BiologyAgarosesM3044Agarose LE - Standard Agarose
Molecular BiologyAgarosesM3054Agarose LE tablets
Molecular BiologyAgarosesM3049Agarose LM - low melting
Molecular BiologyAgarosesM3046Agarose Tiny - low melting, high resolution
Molecular BiologyAgarosesM3047Agarose Tiny HT high resolution, normal melting
Molecular BiologyAgarosesM3051Agarose Mega
Molecular BiologyElectrophoresisM3191SafeGel green stain for DNA electrophoresis
Molecular BiologyElectrophoresisM3199GelRed® in water - Nucleic acid stain
Molecular BiologyElectrophoresisM31790.07 % Ethidium bromide
Molecular BiologyElectrophoresisM3087TAE buffer (50X) ready-to-use solution
Molecular BiologyElectrophoresisM3085TAE buffer (10X) ready-to-use solution
Molecular BiologyElectrophoresisM3206TBE buffer (10X) ready-to-use solution
Molecular BiologyElectrophoresisM3088TBE buffer (10X) ready-to-use solution (MB-Grade)
Molecular BiologyNGSS5352NGS DNA Purification MagBeads
Molecular BiologyNGSM4400DNA Library Prep Kit for Illumina
Molecular BiologyNGSM4401DNA Library Prep Kit PLUS for Illumina
Molecular BiologyDNA Marker / DNA LadderM3072GenLadder 50bp Plus (ready-to-use) with Orange G
Molecular BiologyDNA Marker / DNA LadderGM3094GenLadder 100 bp Plus with loading dye
Molecular BiologyDNA Marker / DNA LadderM3237GenLadder 100 bp Plus with gel staining dye
Molecular BiologyDNA Marker / DNA LadderM3328GenLadder 1kb (ready-to-use) DNA marker
Molecular BiologyDNA Marker / DNA LadderGM3084GenLadder XLarge up to 25 kbp - ready-to-use
Molecular BiologyDNA Marker / DNA LadderM3080pBR322 - Hae III DNA marker
Molecular BiologyDNA Marker / DNA LadderM3081pUC18/pUC19 (undigested)
Molecular BiologyDNA Marker / DNA LadderM3073Lambda-DNA (undigested)
Molecular BiologyModifying EnzymesM3036Proteinase K Powder
Molecular BiologyModifying EnzymesM3037Proteinase K Solution (20mg/mL)
Molecular BiologyModifying EnzymesM3116Proteinase Low-Temp - Solution (200 units/mL)
Molecular BiologyModifying EnzymesM3028DNase I
Molecular BiologyModifying EnzymesS5231Ribonuclease A (RNase A)
Molecular BiologyModifying EnzymesS5218Ribonuclease A (RNase A) - DNase-free
Molecular BiologyModifying EnzymesM3027T4 DNA-Ligase
Cell Culture MediaC4030DMEM w/o L-glutamine, L-cystine, L-methionine, Glucose, Sodium pyruvate
Cell Culture MediaC4150DMEM w/o L-glutamine, amino acids, with 1g/L Glucose
Cell Culture MediaC4031DMEM with 1g/L Glucose, w/o L-glutamine, L-isoleucine
Cell Culture MediaC4230DMEM w/o L-glutamine, L-arginine, L-lysine, Glucose, Sodium pyruvate
Cell Culture MediaC4039DMEM for SILAC w/o L-glutamine, L-arginine, L-lysin, with 4.5g/L Glucose
Cell Culture MediaC4117DMEM w/o L-cysteine, L-methionine, L-glutamine, with 4.5g/L Glucose
Cell Culture MediaC4265DMEM w/o L-arginine, L-glutamine, with Sodium pyruvate, 4.5g/L Glucose
Cell Culture MediaC4041DMEM w/o L-glutamine, NEAAs, with 4.5g/L Glucose
Cell Culture MediaC4331DMEM with L-glutamine, 4.5g/L Glucose, w/o L-serine
Cell Culture MediaC4332DMEM with L-glutamine, w/o Glucose, L-serine
Cell Culture MediaC4353DMEM w/o L-glutamine, amino acids, with 4.5g/L Glucose
Cell Culture MediaC4048DMEM w/o L-glutamine, L-arginine, L-lysin, L-methionine with 4.5g/L Glucose
Cell Culture MediaC4359DMEM w/o L-glutamine, Sodium pyruvate, Phenol red with 4.5g/L Glucose
Cell Culture MediaC4036DMEM with L-glutamine, 4,5g/L Glucose
Cell Culture MediaC4024DMEM w/o L-glutamin, with 1.0g/L Glucose
Cell Culture MediaC4324DMEM with stable glutamine, 1.0g/L Glucose
Cell Culture MediaC4329DMEM with L-glutamine, 1.0g/L Glucose
Cell Culture MediaC4027DMEM w/o L-glutamine, with 1.0g/L Glucose
Cell Culture MediaC4028DMEM with stable glutamine, 4.5g/L Glucose
Cell Culture MediaC4207DMEM with L-glutamine, 4.5g/L Glucose, w/o Phenol red
Cell Culture MediaC4035DMEM w/o L-glutamine, with 4,5g/L Glucose
Cell Culture MediaC4015DMEM:F12, 1:1 Mix w/o L-methionine, with HEPES
Cell Culture MediaC4018DMEM:F12, 1:1 Mix w/o L-cystine, L-cysteine hydrochloride, L-methionine, with Glucose
Cell Culture MediaC4020DMEM:F12, 1:1 Mix w/o Phenol red
Cell Culture MediaC4016DMEM:F12, 1:1 Mix w/o amino acids, with Glucose
Cell Culture MediaC4017DMEM:F12, 1:1 Mix with stable glutamine, HEPES
Cell Culture MediaC4021DMEM:F12, 1:1 Mix with L-glutamine, w/o Glucose
Cell Culture MediaC4022DMEM:F12, 1:1 Mix w/o L-glutamine, Glucose
Cell Culture MediaC4029DMEM/F12, 1:1 Mix w/o L-glutamine, Glucose, with Sodium pyruvate
Cell Culture MediaC4046DMEM:F12, 1:1 Mix with stable glutamine
Cell Culture MediaC4023DMEM:F12, 1:1 Mix with L-glutamine, 15mM HEPES
Cell Culture MediaC4071DMEM:F12, 1:1 Mix with stable glutamine, HEPES
Cell Culture MediaC4068DMEM/F12, 1:1 Mix with stable glutamine, Glucose
Cell Culture MediaC4099RPMI 1640 w/o L-cystine, L-methionine
Cell Culture MediaC4102RPMI 1640 with 20mM Hepes, stab. glutamine, 1mM Sodium pyruvate, NEAAs
Cell Culture MediaC4115RPMI 1640 w/o amino acids, folic acid
Cell Culture MediaC4110RPMI 1640, with L-glutamine, 110mg/L pyruvate
Cell Culture MediaC4111RPMI 1640 w/o Ca, L-glutamine
Cell Culture MediaC4112RPMI 1640 w/o L-glutamine, L-isoleucine
Cell Culture MediaC4113RPMI 1640 w/o Glucose, L-glutamine
Cell Culture MediaC4114RPMI 1640 with L-glutamine, w/o Glucose
Cell Culture MediaC4116RPMI 1640 with stab. glutamine, w/o Phenol red, Glucose
Cell Culture MediaC4095RPMI 1640 with L-glutamine
Cell Culture MediaC4106RPMI 1640 with L-glutamine, 25mM Hepes
Cell Culture MediaC4107RPMI 1640 with stable glutamine, 25mM Hepes
Cell Culture MediaC4081MEM Eagle with Earle´s BSS w/o L-glutamine, NaHCO3
Cell Culture MediaC4082MEM Eagle with Earle´s BSS w/o L-glutamine, NaHCO3, with 20mM Hepes
Cell Culture MediaC4087MEM Eagle with Earle´s BSS with D-Valine, w/o L-glutamine
Cell Culture MediaC4093MEM Eagle with Hank´s BSS with L-glutamine, 0.60g/L NaHCO3
Cell Culture MediaC4330MEM Eagle with Earle´s BSS w/o L-glutamine, Phenol red
Cell Culture MediaC4080MEM Eagle with Earle´s BSS with L-glutamine, 20mM Hepes
Cell Culture MediaC4042EMEM optimized for Fibroblasts, w/o L-glutamine
Cell Culture MediaC4275Alpha MEM Eagle with nucleosides, with L-glutamine, w/o Glucose
Cell Culture MediaC4077Alpha MEM Eagle w/o Nucleosides, L-arginine, L-lysine
Cell Culture MediaC4323Alpha MEM Eagle w/o L-glutamine, Nucleosides
Cell Culture MediaC4007Alpha MEM Eagle with Nucleosides, w/o amino acids
Cell Culture MediaC4276Alpha MEM Eagle with Nucleosides, L-glutamine, Glucose
Cell Culture MediaC4006Alpha MEM Eagle w/o Nucleosides, with L-gluamine, with Glucose
Cell Culture MediaC4003Alpha MEM Eagle with Nucleosides, L-glutamine, Glucose
Cell Culture MediaC4047Ham´s F-10 Medium w/o L-glutamine, Phenol red
Cell Culture MediaC4050Ham´s F-10 Medium with stable glutamine, w/o Phenol red
Cell Culture MediaC4278Ham´s F-10 Medium w/o L-glutamine
Cell Culture MediaC4322Ham´s F-12 Medium w/o L-glutamine, with 2.5g/L NaHCO3
Cell Culture MediaC4271Ham´s F-12 Medium with L-glutamine, w/o Phenol red
Cell Culture MediaC4054Ham´s F-12 Medium w/o folic acid
Cell Culture MediaC4053Ham´s F-12 Medium with stable glutamine
Cell Culture MediaC4268McCoy´s 5A Medium (Modified) w/o L-glutamine, Phenol red
Cell Culture MediaC4269McCoy´s 5A Medium (Modified) with L-glutamine, w/o Phenol red
Cell Culture MediaC4065McCoy´s 5A Medium (Modified) with L-glutamine
Cell Culture MediaC4354Leibovitz´s L-15 Medium w/o L-glutamine, NaHCO3
Cell Culture MediaC4360Leibovitz´s L-15 Medium with L-glutamine, 2.0g/L NaHCO3
Cell Culture MediaC4074Medium 199 with Earle´s BSS w/o L-glutamine, phenol red, with 25 mM Hepes
Cell Culture MediaC4266Medium 199 with Hank´s BSS, 15mM Hepes
Cell Culture MediaC4070Medium 199 with Earle´s BSS w/o L-glutamine, with 0.35 g/L NaHCO3
Cell Culture MediaC4069Medium 199 with Earle´s BSS w/o L-glutamine
Cell Culture MediaC4272Iscove´s Modified Dulbecco´s Medium with stable glutamine, 25 mM Hepes, w/o Phenol red
Cell Culture MediaC4056Iscove´s Modified Dulbecco´s Medium w/o L-glutamine, with 20 mM Hepes
Cell Culture MediaC4058Iscove´s Modified Dulbecco´s Medium w/o L-glutamin, with 25 mM Hepes
Cell Culture MediaC4057Iscove´s Modified Dulbecco´s Medium with L-glutamin, 25 mM Hepes
Cell Culture MediaC4044Glasgow-MEM (BHK 21) with L-glutamine, Tryptose phosphate
Cell Culture MediaC4767Glasgow-MEM (BHK 21) powder w/o L-glutamine, Tryptose phosphate
Cell Culture MediaC4043Glasgow-MEM (BHK 21) with L-glutamine, Tryptose phosphate
Cell Culture MediaC4045Glasgow-MEM (BHK 21) w/o L-glutamine, Tryptose phosphate
Cell Culture MediaC4318William´s Medium E w/o L-glutamine, Glucose, Phenol red
Cell Culture MediaC4312William´s Medium E with stab. Glutamine, w/o Phenol Red
Cell Culture MediaC4317William´s Medium E w/o L-glutamine, Glucose
Cell Culture MediaC4319William´s Medium E w/o L-glutamine, Glucose, Sodium pyruvate
Cell Culture MediaC4121William´s Medium E w/o L-glutamine, Phenol red
Cell Culture MediaC4316William´s Medium E with stab. glutamine
Cell Culture MediaC4274Basal Medium (Eagle) with EBSS, w/o Phenol red
Cell Culture MediaC4009Basal Medium (Eagle) with EBSS w/o NaHCO3
Cell Culture MediaC4012Basal Medium (Eagle) with EBSS, w/o L-glutamine
Cell Culture MediaC4756CMRL-1066 with L-glutamine
Cell Culture MediaC4755CMRL-1066 w/o L-glutamine, Phenol red
Cell Culture MediaC4277Schneider´s Drosophila Medium w/o L-glutamine, L-methionine
Cell Culture MediaC4192Schneider´s Drosophila Medium w/o L-glutamine
Cell Culture MediaC4193Schneider´s Drosophila Medium with L-glutamine
Cell Culture MediaC4195TC-100 Insect Medium w/o L-glutamine
Cell Culture MediaC4194TC-100 Insect Medium with L-glutamine
Cell Culture MediaC4296TC-100 Insect Medium w/o L-glutamine, L-methionine
Cell Culture MediaC4190IPL-41 Insect Medium w/o L-glutamine
Cell Culture MediaC4311IPL-41 Insect Medium with L-glutamine
Cell Culture MediaC4765IPL-41 Insect Medium w/o L-glutamine
Cell Culture MediaC4191TNM-FH Insect-Medium Special
Cell Culture MediaC4299TNM-FH Insect-Medium with FBS
Cell Culture MediaC4188Grace´ Insect Medium w/o L-glutamine
Cell Culture MediaC4338Insect Profree - Sf9 / Sf21
Cell Culture MediaC4153ISF-1 Medium for Hybridoma
Cell Culture MediaC4206Serafree 293-FS serum free medium for HEK cells
Cell Culture MediaC4369Serum Replacement NTA
Cell Culture ReagentsAntibioticsM3448Amoxicillin trihydrate
Cell Culture ReagentsAntibioticsM3122Gentamycin sulfate solution
Cell Culture ReagentsAntibioticsM3109Amphotericin B solution
Cell Culture ReagentsAntibioticsM3108Amphotericin B powder
Cell Culture ReagentsAntibioticsM3218Antibiotic Antimycotic Solution (100X)
Cell Culture ReagentsAntibioticsM3450Apramycin sulfate
Cell Culture ReagentsAntibioticsM3111Bacitracin powder, min. 55 IU/mg
Cell Culture ReagentsAntibioticsM3112Bleomycin sulfate, lyophil. Pure
Cell Culture ReagentsAntibioticsM3147Doxycycline Hyclat
Cell Culture ReagentsAntibioticsM3118G418 - 50mg/Ml
Cell Culture ReagentsAntibioticsM3117G418 powder
Cell Culture ReagentsAntibioticsM3121Gentamycin sulfate powder
Cell Culture ReagentsAntibioticsM3126Hygromycin B solution - 50mg/Ml
Cell Culture ReagentsAntibioticsM3226Isoniazid
Cell Culture ReagentsAntibioticsM3132Kanamycin sulfate 50 mg/Ml
Cell Culture ReagentsAntibioticsM3131Kanamycin sulfate 10 mg/Ml
Cell Culture ReagentsAntibioticsM3140Penicillin-Streptomycin (10000 U/mL)
Cell Culture ReagentsAntibioticsM3429Phleomycin powder
Cell Culture ReagentsAntibioticsM3227Pyrazinecarboxamide
Cell Culture ReagentsAntibioticsM3145Spectinomycin dihydrochloride pentahydrate
Cell Culture ReagentsCell Dissociation ReagentsC42890.05% Trypsin in PBS with 0.02% EDTA, with Phenol red, w/o Mg2+, Ca2+
Cell Culture ReagentsCell Dissociation ReagentsC42600.05% Trypsin in PBS with 0.02% EDTA, w/o Mg2+, Ca2+
Cell Culture ReagentsCell Dissociation ReagentsC42610.05% Trypsin and 0.1% EDTA in PBS w/o Mg2+, Ca2+, w/o Phenol red
Cell Culture ReagentsCell Dissociation ReagentsC42880.25% Trypsin in HBSS with 1mM EDTA, w/o Mg and Ca, with Phenol red
Cell Culture ReagentsCell Dissociation ReagentsC42670.25% Trypsin in PBS with 0.02% EDTA
Cell Culture ReagentsCell Dissociation ReagentsC42590.25% Trypsin in PBS w/o Mg and Ca
Cell Culture ReagentsCell Dissociation ReagentsC42620.25% Trypsin in PBS with 0.02% EDTA with Phenol red
Cell Culture ReagentsCell Dissociation ReagentsC42610.5% Trypsin in PBS with 0.2% EDTA - 10X solution
Cell Culture ReagentsCell Dissociation ReagentsC42872.5% Trypsin in PBS (10X)
Cell Culture ReagentsCell Dissociation ReagentsC4356Accutase® Cell Detachment Solution
Cell Culture ReagentsCell Dissociation ReagentsC4255Collagenase Type I (EC 3.4.24.3) >100 units/mg
Cell Culture ReagentsCell Dissociation ReagentsC4341Collagenase Type II (EC 3.4.24.3) >180 units/mg
Cell Culture ReagentsCell Dissociation ReagentsC4346Collagenase Type III (EC 3.4.24.3)
Cell Culture ReagentsCell Dissociation ReagentsC4310Collagenase Type IV (EC 3.4.24.3) >900 units/mg
Cell Culture ReagentsCell Dissociation ReagentsC4263PBS 5x with 1% EDTA without Ca2+ and Mg2+
Cell Culture ReagentsCell Dissociation ReagentsM6077Trypsin from bovine pancreas
Cell Culture ReagentsCell Dissociation ReagentsC4264Trypsin powder from porcine pancreas (1:250)
Cell Culture ReagentsCell Dissociation ReagentsC4352Zymolyase(R) -20T
Cell Culture ReagentsCell Dissociation ReagentsC4366Zymolyase(R) -100T
Cell Culture ReagentsCell Dissociation ReagentsC4281200 mM L-glutamine (100 X)
Cell Culture ReagentsCell Dissociation ReagentsC4297Stable Glutamine
Cell Culture ReagentsCell Dissociation ReagentsC4309Thymidine (2-Deoxythymidine)
Cell Culture ReagentsCell Dissociation ReagentsC4284MEM Amino Acids Solution (50X)
Cell Culture ReagentsCell Dissociation ReagentsC4368Serum Replacement Basic
Cell Culture ReagentsCell Separation ReagentsM3207Caesium chloride (99.9 %)
Cell Culture ReagentsCell Separation ReagentsM3209Ficoll(R) 400 - Polysucrose 400
Cell Culture ReagentsCell Separation ReagentsC4432LEUCO-Human - Cell separation medium
Cell Culture ReagentsCell Separation ReagentsC4435LEUCO-Mouse - Cell separation medium
Cell Culture ReagentsCell Separation ReagentsC4754Lympho-Paque - Cell separation medium
Balanced Salt SolutionsBufferC4217Dulbecco's PBS solution with Ca and Mg, w/o NaHCO3
Balanced Salt SolutionsBufferC4219Dulbecco's PBS solution w/o Mg, Ca, NaHCO3
Balanced Salt SolutionsBufferC4218PBS solution w/o NaHCO3 (10X)
Balanced Salt SolutionsBufferC4220PBS solution w/o Mg, Ca, NaHCO3 (10X)
Balanced Salt SolutionsBufferM6081Sterile Cell Culture Grade Water
BiochemicalsBuffersM6378BES
BiochemicalsBuffersM6362Bicine
BiochemicalsBuffersM6347Bis-Tris
BiochemicalsBuffersM6200CAPS
BiochemicalsBuffersM6258CHAPS
BiochemicalsBuffersM6202CHAPSO
BiochemicalsBuffersM6203CHES
BiochemicalsBuffersM6370Hepes
BiochemicalsBuffersM6033Imidazole
BiochemicalsBuffersM6207MES
BiochemicalsBuffersM6257MOPS
BiochemicalsBuffersM6209PIPES
BiochemicalsBuffersM6208TAPS
BiochemicalsBuffersM6215Tris base
BiochemicalsBuffersM3292SDS Solution, 20%
BiochemicalsBuffersM3315SDS Solution, 5%
BiochemicalsBuffersM3098TE buffer (1X) / Tris-EDTA buffer - pH7.5
BiochemicalsBuffersM3091TE buffer (1X) / Tris-EDTA buffer - pH8.0
BiochemicalsBuffersD2008Carbonate-Bicarbonate buffer tablets (pH9.6)
BiochemicalsBuffersD2009Carbonate-Bicarbonate buffer tablets with Azide (pH9.6)
BiochemicalsBuffersD2002PBS buffer tablets
BiochemicalsBuffersD2038TBS with Tween 20, pH7.6
BiochemicalsBuffersM3171Tween 20
BiochemicalsBuffersM3173Tween 80
BiochemicalsCarbohydrates / Detergents / SubstratesS5047D(+)-Fucose
BiochemicalsCarbohydrates / Detergents / SubstratesS5050D-Galactosamine x HCl
BiochemicalsCarbohydrates / Detergents / SubstratesS5049D(+)-Galactose
BiochemicalsCarbohydrates / Detergents / SubstratesS5192D.(+)-Galacturonic acid
BiochemicalsCarbohydrates / Detergents / SubstratesS5056L-Glucose
BiochemicalsCarbohydrates / Detergents / SubstratesM6045Glycogen
BiochemicalsCarbohydrates / Detergents / SubstratesS5058Hyaluronic acid
BiochemicalsCarbohydrates / Detergents / SubstratesS5066Lactulose
BiochemicalsCarbohydrates / Detergents / SubstratesS5073D-Mannose
BiochemicalsCarbohydrates / Detergents / SubstratesS5069D(+)-Maltose
BiochemicalsCarbohydrates / Detergents / SubstratesS5091D-Raffinose pentahydrate
BiochemicalsCarbohydrates / Detergents / SubstratesS5092L-Rhamnose monohydrate
BiochemicalsCarbohydrates / Detergents / SubstratesS5115D(+)-Trehalose dihydrate
BiochemicalsCarbohydrates / Detergents / SubstratesS5122D-Xylulose
BiochemicalsCarbohydrates / Detergents / SubstratesM6059Polyethylene glycol 400 - PEG 400
BiochemicalsCarbohydrates / Detergents / SubstratesM6060Polyethylene glycol 1000 - PEG 1000
BiochemicalsCarbohydrates / Detergents / SubstratesM3167Polyethylene glycol 4000 - PEG 4000
BiochemicalsCarbohydrates / Detergents / SubstratesM3168Polyethylene glycol 6000 - PEG 6000
BiochemicalsCarbohydrates / Detergents / SubstratesM6061Polyethylene glycol 8000 - PEG 8000
BiochemicalsCarbohydrates / Detergents / SubstratesS5152n-Tridecyl-ß-maltopyranoside (TDM)
BiochemicalsCarbohydrates / Detergents / SubstratesD2010p-Nitrophenylphosphate tablets
BiochemicalsCarbohydrates / Detergents / SubstratesM31583,3'5,5'-Tetramethylbenzidine (TMB)
BiochemicalsCarbohydrates / Detergents / SubstratesM33384-Chloro-1-Naphthol
BiochemicalsCarbohydrates / Detergents / SubstratesM3210Acetyl Coenzyme A (>83% enzymatic)
BiochemicalsCarbohydrates / Detergents / SubstratesM3219Coenzyme A trilithium salt (>93%)
BiochemicalsCarbohydrates / Detergents / SubstratesM3196BCIP
BiochemicalsCarbohydrates / Detergents / SubstratesM3225Bluo-Gal / 5-Bromo-3-indolyl-beta-D-galactopyranoside
BiochemicalsCarbohydrates / Detergents / SubstratesM3224D-Glucose-6-phosphate disodium
BiochemicalsCarbohydrates / Detergents / SubstratesM3197IPTG, dioxane free
BiochemicalsCarbohydrates / Detergents / SubstratesS4100D-Luciferin potassium salt
BiochemicalsCarbohydrates / Detergents / SubstratesM6058NADPH (tetrasodium salt)
BiochemicalsCarbohydrates / Detergents / SubstratesM6057Nicotinamide adenine dinculeotide phosphate - NADP
BiochemicalsCarbohydrates / Detergents / SubstratesM6056NADH, Nicotinamide adenine dinucleotide
BiochemicalsCarbohydrates / Detergents / SubstratesM6055beta-Nicotinamide adenine dinucleotide - beta-NAD
BiochemicalsCarbohydrates / Detergents / SubstratesM3223Naphthol-AS-D-chloroacetate
BiochemicalsCarbohydrates / Detergents / SubstratesM3202Naphthol-AS-BI-phosphate
BiochemicalsCarbohydrates / Detergents / SubstratesM3203Nitro Blue Tetrazolium Chloride
BiochemicalsCarbohydrates / Detergents / SubstratesM3163Spermine tetrahydrochloride
BiochemicalsCarbohydrates / Detergents / SubstratesM3195Thiazolyl blue tetrazolium bromide (MTT)
BiochemicalsCarbohydrates / Detergents / SubstratesM3204X-Gal / 5-Bromo-4-chloro-3-indolyl-b-D-galactopyranoside
BiochemicalsCarbohydrates / Detergents / SubstratesM3162Putrescine dihydrochloride
BiochemicalsCarbohydrates / Detergents / SubstratesM3205X-β-D-Glucoside / X-Glu / X-Gluc
BiochemicalsCarbohydrates / Detergents / SubstratesS5437Collagenase-Chromophore-Substrate Component A
BiochemicalsCarbohydrates / Detergents / SubstratesM6213Calcium lactate pentahydrate
BiochemicalsCarbohydrates / Detergents / SubstratesM3275Citric acid trisodium salt dihydrate
BiochemicalsCarbohydrates / Detergents / SubstratesS5331Prestained Protein Marker - 10-245 kDa
BiochemicalsCarbohydrates / Detergents / SubstratesS5332Prestained Protein Marker - 10-180 kDa
BiochemicalsCarbohydrates / Detergents / SubstratesC4339Gelatin, powder
BiochemicalsCarbohydrates / Detergents / SubstratesM6051Guanidine thiocyanate
BiochemicalsCarbohydrates / Detergents / SubstratesM6046Guanidine hydrochloride
BiochemicalsSolventsM6323DMSO, Cell culture grade
BiochemicalsSolventsM6324DMSO, Molecular biology grade
BiochemicalsSolventsM6325DMSO, p. A.
BiochemicalsSolventsM6023Diethylene glycol
BiochemicalsSolventsM6029Ethylene glycol
BiochemicalsSolventsM6080Cleaning solution
BiochemicalsDyes / StainsM3199GelRed in water - Nucleic acid stain
BiochemicalsDyes / StainsM3193SafeGel red stain
BiochemicalsDyes / StainsM3191SafeGel green stain
BiochemicalsDyes / StainsM3320Fast Blue B salt
BiochemicalsDyes / StainsM3176DAPI - 4',6-Diamidino-2-phenylindole dihydrochloride
BiochemicalsDyes / StainsM3181Propidium iodide
BiochemicalsDyes / StainsM3312Xylene Cyanol FF
BiochemicalsDyes / StainsM3179Ethidium bromide
BiochemicalsDyes / StainsM3350Ponceau S Solution
BiochemicalsDyes / StainsM3180Orange G
BiochemicalsDyes / StainsA351513ROX Passive Reference Dye
BiochemicalsDyes / StainsM3217Green DNA Dye
Peptides & ProteinsPeptidesP2784Variant Omicron B.1.1.529 BA.5 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)
Peptides & ProteinsPeptidesP2782Epsilon Variant (B.1.427/B.1.429) Peptide Pool SARS-CoV-2 (Spike Glycoprotein)
Peptides & ProteinsPeptidesP2783Eta Variant (B.1.525) Peptide Pool SARS-CoV-2 (Spike Glycoprotein)
Peptides & ProteinsPeptidesP2781Omicron Variant B.1.1.529 Peptide Pool SARS-CoV-2 (Spike Glycoprotein)
Peptides & ProteinsPeptidesP2780Variant Omicron B.1.1.529 Peptide Pool SARS-CoV-2 full length (Spike Glycoprotein)
Peptides & ProteinsPeptidesP4016Variant B.1.617.1 (Kappa ) Peptide Pool SARS-CoV-2 (Spike Glycoprotein)
Peptides & ProteinsPeptidesP4014SARS-CoV-2 (Spike Glycoprotein) Peptide Pool - 316 peptides
Peptides & ProteinsPeptidesP4013Variant B.1.617.2 (Delta) Peptide Pool SARS-CoV-2 (Spike Glycoprotein)
Peptides & ProteinsPeptidesP4012SARS-CoV-2 Surface GP_1 A3 (378-386) - KCYGVSPTK
Peptides & ProteinsPeptidesP4011SARS-CoV-2 Surface GP_1 A1 (865-873) - LTDEMIAQY
Peptides & ProteinsPeptidesP4010SARS-CoV-2 Surface GP A2 (1000-1008) - YLQPRTFLL
Peptides & ProteinsPeptidesP4009SARS-CoV-2 Nucleocapsid _3 B7 KPRQKRTAT
Peptides & ProteinsPeptidesP4008SARS-CoV-2 Nucleocapsid _2 B7 SPRWYFYYL
Peptides & ProteinsPeptidesP4007SARS-CoV-2 Nucleocapsid _1 B7 FPRGQGVPI
Peptides & ProteinsPeptidesP4006SARS-CoV-2 Nucleocapsid A2 (N223-231) LLLDRLNQL
Peptides & ProteinsPeptidesP4005SARS-CoV-2 Membrane GP A2 (61-70) TLACFVLAAV
Peptides & ProteinsPeptidesP4004SARS-CoV-2 Nucleocapsid A2 (226-234) LALLLLDRL
Peptides & ProteinsPeptidesP4003SARS-CoV-2 Nucleocapsid A2 (219-227) LQLPQGTTL
Peptides & ProteinsPeptidesP4002SARS-CoV-2 Nucleocapsid A2 (316-324) GMSRIGMEV
Peptides & ProteinsPeptidesP4001SARS-CoV-2 Nucleocapsid A2 (138-146) - ALNTPKDHI
Peptides & ProteinsPeptidesP4000SARS-CoV SSp-1 A2 (HLA-A*02:01) - RLNEVAKNL
Peptides & ProteinsBioactive ProteinsP2293FLAG-Peptide - DYKDDDDK
Peptides & ProteinsBioactive ProteinsP23003x FLAG Peptide - DYKDDDDK-DYKDDDDK-MDYKDDDDK
Peptides & ProteinsBioactive ProteinsP2299human LL-37 LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Peptides & ProteinsBioactive ProteinsP2955human LL-37 GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Peptides & ProteinsBioactive ProteinsM3105Albumin from hen egg white - Ovalbumin
Peptides & ProteinsBioactive ProteinsM3177Ovalbumin (crude)
Peptides & ProteinsBioactive ProteinsM3100Bovine albumin crystallized, free of fatty acid, free of globulin
Peptides & ProteinsBioactive ProteinsM3103Bovine albumin Fraction V (pH 7.0)
Peptides & ProteinsBioactive ProteinsM3101Bovine albumin for EIA and RIA
Peptides & ProteinsBioactive ProteinsM3104Bovine Serum Albumin, very low endotoxin, no IgG